RetrogeneDB ID: | retro_sara_72 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | GeneScaffold_2004:114403..114651(+) | ||
| Located in intron of: | ENSSARG00000003526 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PTS | ||
| Ensembl ID: | ENSSARG00000001975 | ||
| Aliases: | None | ||
| Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
| Percent Identity: | 85.71 % |
| Parental protein coverage: | 57.24 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | IDPVTGMVINLTSLKEYMEEAIMKPLDHKNLDLDVPYFANIVSTTENVAVYIWESLQKFLPVGVLYKVKV |
| ....TGMVINLTSLKEYMEEAIMKPLDHKNLDLDV..FA.IVSTTENVAVYIWESLQKFLPVGVLYKVK. | |
| Retrocopy | LNTITGMVINLTSLKEYMEEAIMKPLDHKNLDLDVLHFASIVSTTENVAVYIWESLQKFLPVGVLYKVKA |
| Parental | -YETDNNVVVYKGE |
| .Y.TDNN.VVYKG. | |
| Retrocopy | <YDTDNNIVVYKGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003968 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000003770 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000013915 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
| Felis catus | ENSFCAG00000024702 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000023388 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001975 | 2 retrocopies |
retro_sara_163, retro_sara_72 ,
|
| Sus scrofa | ENSSSCG00000015040 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010526 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000000061 | 1 retrocopy |