RetrogeneDB ID: | retro_pvam_351 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | GeneScaffold_268:304192..304431(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SRP9 | ||
| Ensembl ID: | ENSPVAG00000008142 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 9kDa [Source:HGNC Symbol;Acc:11304] |
| Percent Identity: | 63.41 % |
| Parental protein coverage: | 94.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGSLCIKVTDDLVCLVYR-TDQAQDVKKIEKFHSQL |
| MPQYQT...F..AAEK.YLAD..K...V.K.RHS..S.C.KVT.DLVCLVYR.T.QAQ.V.KIEKF.S.. | |
| Retrocopy | MPQYQTFKKFRHAAEKAYLADALKLHAVHKCRHSYESQCSKVTGDLVCLVYR<TNQAQNV*KIEKFQSTN |
| Parental | MRLMVAKESRSV |
| ....VAKES.SV | |
| Retrocopy | V-IVVAKESCSV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000012291 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001752 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008142 | 2 retrocopies |
retro_pvam_1064, retro_pvam_351 ,
|
| Tupaia belangeri | ENSTBEG00000005634 | 3 retrocopies |