RetrogeneDB ID: | retro_ptro_927 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 14:62884719..62884905(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS28 | ||
| Ensembl ID: | ENSPTRG00000040141 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S28 [Source:HGNC Symbol;Acc:10418] |
| Percent Identity: | 64.52 % |
| Parental protein coverage: | 89.86 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLTLLESE |
| MDTSRV..IK.A..T.VLG.T.SQGQC.....EF.D..S.SII.NVKGPV...DVLTLLES. | |
| Retrocopy | MDTSRVRHIKRAWGTMVLGMTSSQGQCMGMDMEFVDNRSHSIIHNVKGPVCKDDVLTLLESK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 177 .49 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 71 .02 RPM |
| SRP007412_heart | 0 .00 RPM | 67 .79 RPM |
| SRP007412_kidney | 0 .00 RPM | 248 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 135 .03 RPM |
| SRP007412_testis | 0 .00 RPM | 11 .07 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1352 |
| Gorilla gorilla | retro_ggor_1052 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000233927 | 9 retrocopies | |
| Loxodonta africana | ENSLAFG00000029923 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000028895 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000003890 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000067288 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000040141 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042886 | 2 retrocopies |