RetrogeneDB ID: | retro_ptro_3312 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | Y:25616360..25616594(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP5J | ||
| Ensembl ID: | ENSPTRG00000013809 | ||
| Aliases: | None | ||
| Description: | ATP synthase-coupling factor 6, mitochondrial [Source:UniProtKB/TrEMBL;Acc:H2QKV8] |
| Percent Identity: | 78.05 % |
| Parental protein coverage: | 68.1 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | VAFNK-ELDPIQKLFVDKIREYKSKRQTSGGPVDAGSEYQQELEREL-SKLKQMFGNADMNTFPT-FKFE |
| VAFNK.ELDP.QKLF.DKIREYKSKRQTSGGPVD....YQQ.LEREL..KL.Q.....DMN.FPT.FKFE | |
| Retrocopy | VAFNK<ELDPLQKLFMDKIREYKSKRQTSGGPVDTSPQYQQVLEREL<FKLEQIYDKVDMNRFPT<FKFE |
| Parental | DPKFEVIEKPQA |
| DPKFEVIEKPQA | |
| Retrocopy | DPKFEVIEKPQA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 48 .40 RPM |
| SRP007412_cerebellum | 0 .54 RPM | 40 .08 RPM |
| SRP007412_heart | 0 .73 RPM | 176 .19 RPM |
| SRP007412_kidney | 0 .44 RPM | 94 .54 RPM |
| SRP007412_liver | 0 .75 RPM | 67 .43 RPM |
| SRP007412_testis | 0 .00 RPM | 71 .24 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4920 |