RetrogeneDB ID: | retro_ptro_3103 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | X:37616816..37617139(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MOBKL1B | ||
| Ensembl ID: | ENSPTRG00000012079 | ||
| Aliases: | MOBKL1B, MOB1A, MOBK1B | ||
| Description: | None |
| Percent Identity: | 59.09 % |
| Parental protein coverage: | 50.46 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | TEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET-LFPSKIGVPFPKNF |
| .E..TEASC.VMS.G...EY..A.GTNI..P.K...PKY.DYLM....D..D.ET..F.S.IGV.F.KNF | |
| Retrocopy | SELYTEASCSVMSSGLISEYYGAGGTNINNPVKVFVPKYNDYLMA*L*DYIDHET<FFSSNIGVLFSKNF |
| Parental | MSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFK |
| MSVAKTI.K.LF..YAHI...HF.SV.Q.QE..H.NT.FK | |
| Retrocopy | MSVAKTI-KCLFKFYAHISY*HFGSVVQPQENSHGNTFFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .68 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .96 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .77 RPM |
| SRP007412_kidney | 0 .00 RPM | 43 .70 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .67 RPM |
| SRP007412_testis | 0 .00 RPM | 35 .62 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4670 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007277 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018245 | 1 retrocopy | |
| Homo sapiens | ENSG00000114978 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010015 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000014338 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000015208 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000321 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003504 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012284 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012079 | 2 retrocopies |
retro_ptro_3103 , retro_ptro_837,
|
| Rattus norvegicus | ENSRNOG00000042657 | 2 retrocopies |