RetrogeneDB ID: | retro_ptro_2804 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:6348096..6348534(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPTRG00000039581 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 96.58 % |
| Parental protein coverage: | 98.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | GYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQ |
| GYRRVFEEYM.VISQ.YPDIRIEGENYLPQP.YRHIASFLSVFKLVLI.LIIVGKDPFAFFGMQAPSIWQ | |
| Retrocopy | GYRRVFEEYMWVISQGYPDIRIEGENYLPQPMYRHIASFLSVFKLVLISLIIVGKDPFAFFGMQAPSIWQ |
| Parental | WGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDS |
| WGQENKVYA.MMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDS | |
| Retrocopy | WGQENKVYASMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDS |
| Parental | IPHHRS |
| IPHHRS | |
| Retrocopy | IPHHRS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 1 .45 RPM | 17 .82 RPM |
| SRP007412_cerebellum | 1 .94 RPM | 14 .09 RPM |
| SRP007412_heart | 0 .64 RPM | 9 .15 RPM |
| SRP007412_kidney | 2 .88 RPM | 25 .39 RPM |
| SRP007412_liver | 1 .11 RPM | 7 .95 RPM |
| SRP007412_testis | 0 .21 RPM | 9 .27 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4126 |
| Pongo abelii | retro_pabe_3478 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001394 | 2 retrocopies | |
| Equus caballus | ENSECAG00000025123 | 2 retrocopies | |
| Homo sapiens | ENSG00000198843 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028291 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014738 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000021273 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000075700 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003284 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000014425 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000039581 | 1 retrocopy |
retro_ptro_2804 ,
|
| Rattus norvegicus | ENSRNOG00000013507 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018506 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007410 | 3 retrocopies |