RetrogeneDB ID: | retro_ptro_2633 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:64926165..64926547(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GRPEL1 | ||
| Ensembl ID: | ENSPTRG00000015894 | ||
| Aliases: | None | ||
| Description: | GrpE protein homolog [Source:UniProtKB/TrEMBL;Acc:H2QP70] |
| Percent Identity: | 65.89 % |
| Parental protein coverage: | 58.99 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | TKQKNSGQNLEEDMG-QSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEA |
| TKQKNS.Q.LEED...Q.....D.P...K.L.EE.VKLEEQ.KE.VE..K.ALADTE...Q.SQKLV.EA | |
| Retrocopy | TKQKNSCQQLEEDVD>QTKWGTDTPSMDKILMEE-VKLEEQPKEAVEEDKQALADTEDSQQSSQKLVGEA |
| Parental | KLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKH |
| ....IQ.FCKD.LE.ADVLEKATQCVP.EEIKD.N.HLKNL.E.L.M.E.QIQ.VF.KH | |
| Retrocopy | NMCSIQGFCKDSLELADVLEKATQCVPEEEIKDNNHHLKNLCETLTMSEGQIQEVFSKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 24 .36 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 25 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 26 .55 RPM |
| SRP007412_kidney | 0 .05 RPM | 42 .71 RPM |
| SRP007412_liver | 0 .00 RPM | 53 .55 RPM |
| SRP007412_testis | 0 .53 RPM | 38 .46 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3864 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014364 | 1 retrocopy | |
| Homo sapiens | ENSG00000109519 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000002590 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000002955 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010471 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011822 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000032291 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000011314 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014573 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015894 | 3 retrocopies |
retro_ptro_2544, retro_ptro_2633 , retro_ptro_2636,
|
| Pan troglodytes | ENSPTRG00000017396 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007667 | 1 retrocopy |