RetrogeneDB ID: | retro_ptro_2301 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 5:134376657..134377094(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DNAJC24 | ||
| Ensembl ID: | ENSPTRG00000003471 | ||
| Aliases: | DNAJC24, DPH4, ZCSL3 | ||
| Description: | None |
| Percent Identity: | 61.33 % |
| Parental protein coverage: | 99.33 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | MMAVEQMPKKDWYSI-LGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQ-KFIEIDQAWKI |
| .MA.E.MPK..WYSI.LGADP..N.S.LK.KY.KL.L..H.D.QSTDVPAG.VE.C.Q.K........K. | |
| Retrocopy | IMAFELMPKNNWYSI>LGADP--NVSNLKLKYEKLVLKQHSD*QSTDVPAGIVEDCIQ>KSLKLIRHGKF |
| Parental | LGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDT |
| .G....K.EYD.Q..EDDLRN..P.DAQ.YLE...W...D.SF..SC.CG.K.SVSKDEAEEV.L.SCDT | |
| Retrocopy | *GMKR-KKEYDTQ*HEDDLRNMEPIDAQLYLEKVPWKKDDDSFSPSCQCGRKHSVSKDEAEEVNLFSCDT |
| Parental | CSLIIELLHY |
| CSLI.ELLHY | |
| Retrocopy | CSLITELLHY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .04 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .50 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .27 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .42 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .66 RPM |
| SRP007412_testis | 0 .00 RPM | 22 .97 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_2783 |
| Macaca mulatta | retro_mmul_2112 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000013512 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000248 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000003054 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007553 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000006845 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017878 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007848 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001638 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003390 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000003471 | 1 retrocopy |
retro_ptro_2301 ,
|
| Tarsius syrichta | ENSTSYG00000009243 | 1 retrocopy |