RetrogeneDB ID: | retro_ptro_2156 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 5:64121613..64122040(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAGOH | ||
| Ensembl ID: | ENSPTRG00000000753 | ||
| Aliases: | LOC100613301, MAGOH, MAGOHB | ||
| Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
| Percent Identity: | 74.66 % |
| Parental protein coverage: | 99.32 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | ESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITK |
| ES.FYL.YYV.HK.KF.HEFLE.EF.PD.KLR.ANNSNYK..VMIRKEAY..K..MEELKRII..SEITK | |
| Retrocopy | ESNFYLHYYVSHKDKFDHEFLEIEFQPDKKLRCANNSNYKDNVMIRKEAYIYKNMMEELKRIINGSEITK |
| Parental | EDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQD-LKCLVFSLIGLH |
| ..DALWPPPD.....ELEIVIG.EH.SF.TSKIGSLIDV.QSKDPEGLR.FYYLV.D..K.LVF....LH | |
| Retrocopy | *YDALWPPPD---QEELEIVIGHEHVSFITSKIGSLIDVKQSKDPEGLRIFYYLVHD>RKYLVFIVTELH |
| Parental | FKIKPI |
| FKIKPI | |
| Retrocopy | FKIKPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .11 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .15 RPM |
| SRP007412_heart | 0 .00 RPM | 13 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 16 .92 RPM |
| SRP007412_liver | 0 .00 RPM | 23 .24 RPM |
| SRP007412_testis | 0 .00 RPM | 23 .08 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3318 |
| Gorilla gorilla | retro_ggor_1303 |
| Pongo abelii | retro_pabe_2733 |
| Callithrix jacchus | retro_cjac_1858 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004538 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000011511 | 1 retrocopy | |
| Homo sapiens | ENSG00000162385 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007594 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000006406 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002444 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017987 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000001880 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013328 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009020 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001335 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000000753 | 1 retrocopy |
retro_ptro_2156 ,
|
| Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001253 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies |