RetrogeneDB ID: | retro_ptro_2031 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 4:165620216..165620457(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TOMM22 | ||
| Ensembl ID: | ENSPTRG00000014374 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.42 % |
| Parental protein coverage: | 57.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | WGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSR-AALWIGTTSFMI-LVLPVVFETEKLQMEQQQQLQQ |
| WGL.EMF.ER..S.....F..SLFVAQKM.R.SR...LWIGTT.FM...VL.VVFETEKLQMEQ...... | |
| Retrocopy | WGLMEMFSERAGSMVAGAFEISLFVAQKMHRISR<ETLWIGTTFFMM<VVLSVVFETEKLQMEQPGPKRL |
| Parental | RQILLGPNTGLSG |
| .....G....L.G | |
| Retrocopy | PEGMPGAHPSLPG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 36 .50 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 19 .39 RPM |
| SRP007412_heart | 0 .00 RPM | 22 .27 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .05 RPM |
| SRP007412_liver | 0 .00 RPM | 27 .17 RPM |
| SRP007412_testis | 0 .00 RPM | 54 .06 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3003 |
| Pongo abelii | retro_pabe_2489 |