RetrogeneDB ID: | retro_ptro_2015 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 4:130307837..130308107(+) | ||
| Located in intron of: | ENSPTRG00000016433 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C9H9ORF80 | ||
| Ensembl ID: | ENSPTRG00000023472 | ||
| Aliases: | C9H9orf80, C9orf80 | ||
| Description: | Pan troglodytes SOSS complex subunit C-like (C9H9orf80), mRNA. [Source:RefSeq mRNA;Acc:NM_001242593] |
| Percent Identity: | 91.11 % |
| Parental protein coverage: | 86.54 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | RVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFI |
| .VAILAELDKEKR.LLMQNQSSTNHPGASIALSRP.LNKDF.DHAE.Q.IAAQQKAALQHAHAHS.GYFI | |
| Retrocopy | QVAILAELDKEKRRLLMQNQSSTNHPGASIALSRPCLNKDFWDHAEPQYIAAQQKAALQHAHAHSFGYFI |
| Parental | TQDSAFGNLILPVLPRLDPE |
| TQDSAFGNLILPVLP.LDPE | |
| Retrocopy | TQDSAFGNLILPVLPHLDPE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 9 .03 RPM |
| SRP007412_cerebellum | 0 .82 RPM | 10 .43 RPM |
| SRP007412_heart | 0 .09 RPM | 5 .36 RPM |
| SRP007412_kidney | 0 .10 RPM | 10 .09 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .34 RPM |
| SRP007412_testis | 0 .21 RPM | 4 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2980 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006841 | 1 retrocopy | |
| Equus caballus | ENSECAG00000008524 | 1 retrocopy | |
| Homo sapiens | ENSG00000148153 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000001130 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016554 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016717 | 1 retrocopy | |
| Oryzias latipes | ENSORLG00000011577 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000023472 | 1 retrocopy |
retro_ptro_2015 ,
|
| Sorex araneus | ENSSARG00000003661 | 1 retrocopy | |
| Xiphophorus maculatus | ENSXMAG00000002259 | 1 retrocopy |