RetrogeneDB ID: | retro_ptro_185 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:113686974..113687364(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PFN1 | ||
| Ensembl ID: | ENSPTRG00000008616 | ||
| Aliases: | None | ||
| Description: | profilin 1 [Source:HGNC Symbol;Acc:8881] |
| Percent Identity: | 75.38 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | LMADRTCQDAALLGYKDSPSVWAGVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQ |
| L.AD.TC.D.A..G.KD.PS.WA.VPGKTF.NITPAEVGVLVGKD.SSF..NGLTLGGQK..V..DSLLQ | |
| Retrocopy | LVADGTC*DTAIVGNKDPPSIWAAVPGKTFLNITPAEVGVLVGKDWSSFVMNGLTLGGQKYTVVLDSLLQ |
| Parental | DGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
| DGE...DLR.KS.GGAPTFNV.VT.T.KTL.LLMGKEG.HG..INK.CYEMASHL.RSQY | |
| Retrocopy | DGELTTDLRMKSIGGAPTFNVIVTMTAKTLGLLMGKEGIHGNFINK*CYEMASHLQRSQY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .41 RPM | 85 .21 RPM |
| SRP007412_cerebellum | 0 .11 RPM | 113 .21 RPM |
| SRP007412_heart | 0 .09 RPM | 105 .01 RPM |
| SRP007412_kidney | 0 .16 RPM | 290 .99 RPM |
| SRP007412_liver | 0 .10 RPM | 606 .30 RPM |
| SRP007412_testis | 0 .95 RPM | 52 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006193 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000004915 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011719 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000013136 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021116 | 3 retrocopies | |
| Homo sapiens | ENSG00000108518 | 10 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022394 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002772 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000018293 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017446 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031395 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000000291 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000004124 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008616 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003975 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000017905 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028950 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001299 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000005327 | 3 retrocopies |