RetrogeneDB ID: | retro_ptro_1156 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 16:76314950..76315346(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAD2L1 | ||
| Ensembl ID: | ENSPTRG00000016401 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 64.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | ALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQ |
| AL.LS.E..ITL..SA.IV..FFSFGINSIL.Q.GIYPS.TFT.V.KYGLTLLVTT.LEL.K.LNN.VEQ | |
| Retrocopy | ALKLSWEKDITLCRSAKIVVKFFSFGINSILFQHGIYPSGTFTPVWKYGLTLLVTTNLELMKHLNNMVEQ |
| Parental | LKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIR |
| LK.WLY..S.QKL..VIS.IES.EVL.RWQFD..CDKTAKD...PRE.SQK.IQDEI..VIR | |
| Retrocopy | LKHWLYQRSGQKLIGVISTIESDEVLQRWQFDPKCDKTAKDHLGPRE*SQKTIQDEICLVIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .32 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .98 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .19 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .15 RPM |
| SRP007412_liver | 0 .03 RPM | 1 .83 RPM |
| SRP007412_testis | 0 .00 RPM | 15 .91 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1707 |
| Gorilla gorilla | retro_ggor_1281 |
| Pongo abelii | retro_pabe_1403 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012813 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013456 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009629 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000015756 | 1 retrocopy | |
| Homo sapiens | ENSG00000164109 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002516 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000029619 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011092 | 8 retrocopies | |
| Macaca mulatta | ENSMMUG00000004875 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029910 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009092 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004054 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015029 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000016401 | 2 retrocopies |
retro_ptro_1156 , retro_ptro_925,
|
| Ictidomys tridecemlineatus | ENSSTOG00000025410 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000011065 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011017 | 1 retrocopy |