RetrogeneDB ID: | retro_ptro_1079 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 15:86382483..86382865(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | IFT20 | ||
| Ensembl ID: | ENSPTRG00000008911 | ||
| Aliases: | None | ||
| Description: | intraflagellar transport 20 homolog (Chlamydomonas) [Source:HGNC Symbol;Acc:30989] |
| Percent Identity: | 61.54 % |
| Parental protein coverage: | 96.97 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | KDILGEAGLHFDELNK-LRVLDPEVTQQTIELKEECKDFVDKIGQFQK-IVGGLIELVDQLAKEAENEKM |
| .D.LGEAGL.FDEL.K...V.DPEVT.QT...KE.C.DFVDKI..FQK.IVGGLIE.VDQLAK.AENEK. | |
| Retrocopy | QDSLGEAGLCFDELSK<AWVRDPEVT*QTRDPKEDCMDFVDKISPFQK<IVGGLIEPVDQLAKAAENEKR |
| Parental | KAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIF |
| K..GA.NLL...AK.RE.QQQQL.A..AE.KM.L.R...EYEA..KV.A..........F | |
| Retrocopy | KVVGAWNLLQFMAKHRETQQQQLLAQTAEEKMWLKRWWIEYEASWKVDAQKETHLLASLF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .05 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .76 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .09 RPM |
| SRP007412_kidney | 0 .00 RPM | 14 .64 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .92 RPM |
| SRP007412_testis | 0 .11 RPM | 63 .44 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1217 |
| Pongo abelii | retro_pabe_1322 |
| Macaca mulatta | retro_mmul_2234 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005111 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000008110 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003153 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018843 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008709 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000019233 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000014353 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000001105 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000007773 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003333 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000005826 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000008911 | 1 retrocopy |
retro_ptro_1079 ,
|
| Sus scrofa | ENSSSCG00000023719 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000007554 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005557 | 2 retrocopies |