RetrogeneDB ID: | retro_pabe_913 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 12:33268301..33268693(-) | ||
| Located in intron of: | ENSPPYG00000004403 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | WBP2 | ||
| Ensembl ID: | ENSPPYG00000008640 | ||
| Aliases: | None | ||
| Description: | WW domain binding protein 2 [Source:HGNC Symbol;Acc:12738] |
| Percent Identity: | 54.68 % |
| Parental protein coverage: | 51.72 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 4 |
| Parental | EFGQRMLQV-ASQASRGEV-PSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDG |
| .FGQ.ML.V...QASRGE..P....G....P....V.P.PVAN.MY.CPPG.P.P..P.EF.PGPPM.DG | |
| Retrocopy | QFGQ*MLKV>TFQASRGEA>PTEPMGTLTYPTEP-VFPLPVANAMYLCPPGCPNPQSPSEF*PGPPMVDG |
| Parental | AMGYVQPPPPPYPGP-MEPPVSGPDVPSTPAAEAKAAEAAASAYYN-PGNPHNVYMPTSQPPPPPYYPP |
| AMG..Q..P.PY.G..MEP.V.GP..PS..A..AKA...AA.A....PGNPHN.Y.P..QP.P..YY.P | |
| Retrocopy | AMGCLQSLPLPYLGS<MEPLVRGPIGPS--ALAAKAR--AAEAVVS>PGNPHNTYIPRNQPLPLHYYSP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 436 .63 RPM |
| SRP007412_cerebellum | 0 .49 RPM | 132 .55 RPM |
| SRP007412_heart | 0 .00 RPM | 51 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 117 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 42 .72 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_854 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000004946 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000037619 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005760 | 1 retrocopy | |
| Homo sapiens | ENSG00000132471 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009241 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000070 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009381 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000007725 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000013775 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001625 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006045 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008640 | 3 retrocopies |
retro_pabe_693, retro_pabe_75, retro_pabe_913 ,
|
| Pan troglodytes | ENSPTRG00000009660 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021421 | 2 retrocopies |