RetrogeneDB ID: | retro_pabe_576 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 10:25655485..25655899(-) | ||
| Located in intron of: | ENSPPYG00000002156 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COQ10B | ||
| Ensembl ID: | ENSPPYG00000013045 | ||
| Aliases: | None | ||
| Description: | Coenzyme Q-binding protein COQ10 homolog B, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5RD79] |
| Percent Identity: | 75.71 % |
| Parental protein coverage: | 58.82 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | SATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRKEYSERRILGYSMQE |
| S....G...P..N.RYLASCGILMSR.LPLH.S.L.KEICA.TFF.I.APLINKRK.YSERRILGY.MQE | |
| Retrocopy | SGRSPGSEGPEQNIRYLASCGILMSRALPLHMSFLIKEICAITFFTIAAPLINKRK-YSERRILGYLMQE |
| Parental | MYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNH |
| MYDVV.G.EDYKHF..WCKKSD.IS.RSGY.KT.LEI.FP.VLE.Y.S.VTLVKPHLVK.SCTDGRLF.H | |
| Retrocopy | MYDVVLGMEDYKHFILWCKKSDIISERSGYYKTQLEIEFPAVLE*Y-SAVTLVKPHLVKVSCTDGRLFKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 15 .09 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .34 RPM |
| SRP007412_heart | 0 .00 RPM | 14 .75 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .31 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .05 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_569 |
| Macaca mulatta | retro_mmul_2434 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004659 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000005807 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003971 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003229 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000004090 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000001626 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022385 | 1 retrocopy | |
| Homo sapiens | ENSG00000115520 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023373 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000865 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010488 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000012281 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000025981 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006871 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000010091 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000013045 | 2 retrocopies |
retro_pabe_2758, retro_pabe_576 ,
|
| Pan troglodytes | ENSPTRG00000012772 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014456 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012642 | 2 retrocopies |