RetrogeneDB ID: | retro_pabe_468 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1:177497771..177498209(-) | ||
| Located in intron of: | ENSPPYG00000001352 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ANAPC10 | ||
| Ensembl ID: | ENSPPYG00000015096 | ||
| Aliases: | None | ||
| Description: | anaphase promoting complex subunit 10 [Source:HGNC Symbol;Acc:24077] |
| Percent Identity: | 90.41 % |
| Parental protein coverage: | 90.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | FGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIR |
| FGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTL.IYADYKSDESYTPSKIS..VGNNFHNLQEI. | |
| Retrocopy | FGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLYIYADYKSDESYTPSKISAKVGNNFHNLQEIW |
| Parental | QLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFM |
| QLELVE.SGWIH.PLTDNH.KPT.T.MIQIAVLA.HQNG.DTHMRQIKIYTPVEES.IGKFPRCTT.DFM | |
| Retrocopy | QLELVERSGWIHIPLTDNHRKPTCTLMIQIAVLASHQNGKDTHMRQIKIYTPVEESTIGKFPRCTTVDFM |
| Parental | MYRSIR |
| MY.SIR | |
| Retrocopy | MYCSIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .44 RPM | 1 .55 RPM |
| SRP007412_cerebellum | 0 .36 RPM | 3 .89 RPM |
| SRP007412_heart | 0 .45 RPM | 1 .96 RPM |
| SRP007412_kidney | 0 .50 RPM | 2 .92 RPM |
| SRP007412_liver | 0 .46 RPM | 2 .45 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_152 |
| Pan troglodytes | retro_ptro_149 |
| Gorilla gorilla | retro_ggor_241 |
| Macaca mulatta | retro_mmul_374 |
| Callithrix jacchus | retro_cjac_2999 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002663 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000016690 | 1 retrocopy | |
| Homo sapiens | ENSG00000164162 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025091 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008607 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004432 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000036977 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005453 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006902 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000015096 | 1 retrocopy |
retro_pabe_468 ,
|
| Pan troglodytes | ENSPTRG00000016480 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013169 | 2 retrocopies |