RetrogeneDB ID: | retro_pabe_3565 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | Un:6155671..6156052(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSPPYG00000019936 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LYPLA1 | ||
| Ensembl ID: | ENSPPYG00000018590 | ||
| Aliases: | None | ||
| Description: | acyl-protein thioesterase 1 [Source:RefSeq peptide;Acc:NP_001125450] |
| Percent Identity: | 69.53 % |
| Parental protein coverage: | 55.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGGHGKQSFFMLCYSDFVVFSFPCRPVRPVTLNMNMAM |
| .CGNNMS.PLPA..PA.R.ATA.VIFLHGLGDTG.HG....F....S.......P..PV.PVTLNMNMAM | |
| Retrocopy | LCGNNMSAPLPATEPAPRNATAVVIFLHGLGDTG-HGWAEAFAGIRSSHIKYICPHAPVMPVTLNMNMAM |
| Parental | PSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLY |
| PSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSN......FS.......Y | |
| Retrocopy | PSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNNYFGRIFSGRSFMFIY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .28 RPM | 3 .10 RPM |
| SRP007412_cerebellum | 0 .49 RPM | 10 .70 RPM |
| SRP007412_heart | 0 .42 RPM | 11 .47 RPM |
| SRP007412_kidney | 0 .73 RPM | 14 .09 RPM |
| SRP007412_liver | 0 .83 RPM | 12 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000006978 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011562 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000022715 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000001479 | 1 retrocopy | |
| Equus caballus | ENSECAG00000016530 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001727 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008208 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013157 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001027 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006751 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000001733 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018590 | 3 retrocopies |
retro_pabe_2550, retro_pabe_3177, retro_pabe_3565 ,
|
| Pteropus vampyrus | ENSPVAG00000005246 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008320 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012350 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011836 | 3 retrocopies |