RetrogeneDB ID: | retro_pabe_3106 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 7:138588535..138588840(+) | ||
| Located in intron of: | ENSPPYG00000029654 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFB10 | ||
| Ensembl ID: | ENSPPYG00000006974 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001124813] |
| Percent Identity: | 55.56 % |
| Parental protein coverage: | 61.05 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | MPDSWDKDVYPEPP--RRTP-VLPNPIVYMMKAFDLIVDRPVTLAREFVERQHAKNRYYYYHRQYRRVPD |
| MP.SWDKDVYP..P..R..P..L..PI.Y.MKAFDL.........RE...R.....RYYYY...Y.R.PD | |
| Retrocopy | MPESWDKDVYPKSPCPRSRP<LLHKPITYLMKAFDLLM----AFVRESL*RGSM*RRYYYYQWEYCRMPD |
| Parental | ITECKEEDIMCMYEAEMQWRRDYKVDQEIINIMQDRLK |
| I.ECKE.D..CM..AEMQWRRD.KV..EI..I.Q.RLK | |
| Retrocopy | IIECKE-DVLCMFGAEMQWRRDHKVNEEIAGIIQERLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 43 .73 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 38 .79 RPM |
| SRP007412_heart | 0 .15 RPM | 91 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 73 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 32 .41 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3801 |
| Pan troglodytes | retro_ptro_2578 |
| Gorilla gorilla | retro_ggor_2555 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000019476 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017154 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011738 | 1 retrocopy | |
| Homo sapiens | ENSG00000140990 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009367 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000013152 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029268 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000040048 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008867 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006974 | 2 retrocopies |
retro_pabe_1297, retro_pabe_3106 ,
|
| Pan troglodytes | ENSPTRG00000007618 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014568 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030328 | 1 retrocopy |