RetrogeneDB ID: | retro_pabe_2226 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:82819545..82819701(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBL5 | ||
| Ensembl ID: | ENSPPYG00000009536 | ||
| Aliases: | None | ||
| Description: | ubiquitin-like protein 5 [Source:RefSeq peptide;Acc:NP_001125281] |
| Percent Identity: | 67.31 % |
| Parental protein coverage: | 71.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | DTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ |
| .T..D.K.LIAAQ..T...KI.LKKWY.IFKDH..LGD..IHDGMNLELY.Q | |
| Retrocopy | ETLRDRKTLIAAQAVTHCKKIILKKWYMIFKDHTILGDHDIHDGMNLELYFQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 44 .07 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 43 .65 RPM |
| SRP007412_heart | 0 .00 RPM | 50 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 84 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 68 .39 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2798 |
| Pan troglodytes | retro_ptro_1895 |
| Macaca mulatta | retro_mmul_1437 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006097 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
| Homo sapiens | ENSG00000198258 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000007877 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009536 | 3 retrocopies |
retro_pabe_1489, retro_pabe_2226 , retro_pabe_2814,
|
| Pan troglodytes | ENSPTRG00000010451 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000008628 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023331 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008535 | 1 retrocopy |