RetrogeneDB ID: | retro_pabe_2093 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2b:134239215..134239668(+) | ||
| Located in intron of: | ENSPPYG00000013354 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | KCTD2 | ||
| Ensembl ID: | ENSPPYG00000008616 | ||
| Aliases: | None | ||
| Description: | potassium channel tetramerization domain containing 2 [Source:HGNC Symbol;Acc:21294] |
| Percent Identity: | 72.19 % |
| Parental protein coverage: | 81.08 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | QDETGAYLIDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGP |
| .DET.AYL.DRDPTYFGP.LNYLRHGKL.I.K.L.EEGVLE.AEFY.I.SL..LVK..IR..E..TSQ.P | |
| Retrocopy | KDETVAYLMDRDPTYFGPVLNYLRHGKLVINKDLVEEGVLEKAEFYSITSLIKLVKDKIREQESKTSQVP |
| Parental | VKHVYRVLQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLQVVSRELNNSTNGIVIEPS-E |
| .KHVYRVLQCQEE.LTQ.VSTMSD.WKFEQL.S.GSSYNYGNEDQA.FL.VVS.EL.N.......EPS.. | |
| Retrocopy | MKHVYRVLQCQEEKLTQVVSTMSDSWKFEQLVSNGSSYNYGNEDQARFLYVVSKELHNTLYSTASEPSKK |
| Parental | ARILQERGSRM |
| A.IL.E.GSRM | |
| Retrocopy | AKIL*EQGSRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 21 .95 RPM |
| SRP007412_cerebellum | 0 .36 RPM | 29 .43 RPM |
| SRP007412_heart | 0 .03 RPM | 2 .23 RPM |
| SRP007412_kidney | 0 .03 RPM | 6 .60 RPM |
| SRP007412_liver | 0 .06 RPM | 1 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2224 |
| Pan troglodytes | retro_ptro_1685 |
| Gorilla gorilla | retro_ggor_1752 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000021231 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014605 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013965 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000008616 | 1 retrocopy |
retro_pabe_2093 ,
|
| Pongo abelii | ENSPPYG00000018452 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000009629 | 1 retrocopy |