RetrogeneDB ID: | retro_pabe_1756 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1_random:13781036..13781259(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSPPYG00000015422 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
| Percent Identity: | 54.55 % |
| Parental protein coverage: | 77.32 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | CGSKAYHLQ-KSTCGKCGYPAKRKRKYNWSAKAKRRN-TTGTGRMRHLKIVYRRFRHGFREGTTPKPKRA |
| CGS.A.H.Q..S.CGKCG.PA...RK......A.R...TTGTG.M..LKIV..RFRHGF..GT.P...R. | |
| Retrocopy | CGSEACHPQ<ESACGKCGRPARCPRK*DLGVRANRQK<TTGTGQMMLLKIVCHRFRHGFHDGTAPESQRP |
| Parental | AVAASSS |
| A.AA..S | |
| Retrocopy | AAAAPGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 62 .42 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 60 .68 RPM |
| SRP007412_heart | 0 .00 RPM | 63 .73 RPM |
| SRP007412_kidney | 0 .00 RPM | 73 .02 RPM |
| SRP007412_liver | 0 .00 RPM | 81 .68 RPM |