RetrogeneDB ID: | retro_pabe_1308 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 15:69387233..69387485(-) | ||
| Located in intron of: | ENSPPYG00000006609 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EIF5A2 | ||
| Ensembl ID: | ENSPPYG00000014294 | ||
| Aliases: | None | ||
| Description: | Eukaryotic translation initiation factor 5A-2 [Source:UniProtKB/Swiss-Prot;Acc:Q5R898] |
| Percent Identity: | 84.52 % |
| Parental protein coverage: | 54.9 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | EDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMC |
| EDICPS.HNMDVPNI.R.DYQLI.IQD..LSLLTE...V.EDLKLPE.ELGK.I.GKYNAGEDVQVSVMC | |
| Retrocopy | EDICPSIHNMDVPNIQRHDYQLIRIQDSCLSLLTEADGVPEDLKLPESELGK*IQGKYNAGEDVQVSVMC |
| Parental | AMSEEYAVAIKPCK |
| AMSEEYAVAIKPCK | |
| Retrocopy | AMSEEYAVAIKPCK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .27 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .95 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .54 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .58 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1591 |
| Pan troglodytes | retro_ptro_1070 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005363 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012594 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000014801 | 2 retrocopies | |
| Homo sapiens | ENSG00000163577 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000013225 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007473 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005292 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016657 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007907 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014294 | 2 retrocopies |
retro_pabe_1308 , retro_pabe_1640,
|
| Pan troglodytes | ENSPTRG00000015621 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008130 | 2 retrocopies |