RetrogeneDB ID: | retro_opri_944 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_48473:5937..6157(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOPRG00000002571 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.95 % |
| Parental protein coverage: | 51.41 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MAPKGKVGTR-KKQIFEENRETLKF-YLRIILGANAIYCLVTLVFFYSSASF-WAWMALAFSLAVYGASY |
| MAPK.....R.KK.I...NRETL.F.Y.....GAN..Y.LVTLVFF..SASF.WAW.AL..SL.V...S. | |
| Retrocopy | MAPKDNLDVRGKK*ICSGNRETLEF<YQPVHQGANSVYSLVTLVFFSLSASF<WAWRALGCSLSVSRSSQ |
| Parental | HSMSSM |
| HS.... | |
| Retrocopy | HSVITL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryctolagus cuniculus | ENSOCUG00000026215 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000002571 | 2 retrocopies |
retro_opri_944 , retro_opri_959,
|
| Sus scrofa | ENSSSCG00000002790 | 1 retrocopy |