RetrogeneDB ID: | retro_opri_786 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_30581:38279..38495(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPE | ||
| Ensembl ID: | ENSOPRG00000015415 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
| Percent Identity: | 54.17 % |
| Parental protein coverage: | 78.26 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS |
| MA..GQGQK.Q.VMVQP..LIF.YL.......VW..EQV.M..EGCI.G....MNL..D..E.IHS.T.. | |
| Retrocopy | MASCGQGQKAQRVMVQPTDLIFSYL*VNLTFKVWFHEQVTMWMEGCITGSHKHMNLLIDGKEGIHSET*K |
| Parental | RK |
| .K | |
| Retrocopy | HK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |