RetrogeneDB ID: | retro_opri_1056 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_63187:1443..1766(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS27A | ||
| Ensembl ID: | ENSOPRG00000010469 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S27a [Source:HGNC Symbol;Acc:10417] |
| Percent Identity: | 67.57 % |
| Parental protein coverage: | 71.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | GKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISR |
| G..L.D...L.D..I.K.S.LHLVLRL.G...K..KKSYTTP.KNKHK..KVKLAVLKY.KVD.NG.... | |
| Retrocopy | GQTLSDYNILKDLIILKQSMLHLVLRLCGA--KKMKKSYTTPAKNKHKGNKVKLAVLKYSKVDKNGITAA |
| Parental | -LRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK |
| .L...CPSDECGAGVFMASH.DRHYC.KCCL.YCF.KP.DK | |
| Retrocopy | <LCHKCPSDECGAGVFMASHSDRHYCSKCCLIYCFIKPDDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004017 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000023471 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000010052 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007678 | 9 retrocopies | |
| Loxodonta africana | ENSLAFG00000023133 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017064 | 10 retrocopies | |
| Myotis lucifugus | ENSMLUG00000029449 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015563 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000001819 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000003613 | 10 retrocopies | |
| Ochotona princeps | ENSOPRG00000010469 | 13 retrocopies | |
| Pongo abelii | ENSPPYG00000025871 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011928 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004426 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000009566 | 5 retrocopies |