RetrogeneDB ID: | retro_oniv_49 | ||
Retrocopylocation | Organism: | Indian wild rice (Oryza nivara) | |
| Coordinates: | 6:2772472..2772715(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ONIVA07G23000 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.49 % |
| Parental protein coverage: | 87.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MGKRK---SAAKPPPKKRMDKLDTVFSCPFCNHGSSVECRIDMKNLIGEASCRICQENFSTTVNALTEPI |
| MGKRK...S......KK...KL.T.FSCPFC.HG..VEC.ID.K..I..ASC..CQ...STT..ALTEPI | |
| Retrocopy | MGKRKSRVSKMLATAKKAAPKLETAFSCPFCDHGGAVECSIDIKHMIAVASCFVCQARYSTTAHALTEPI |
| Parental | DIYSEWIDECE |
| D.YSEWID.CE | |
| Retrocopy | DVYSEWIDQCE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryza sativa indica | BGIOSGA007878 | 1 retrocopy | |
| Aegilops tauschii | F775_28085 | 1 retrocopy | |
| Hordeum vulgare | MLOC_14907 | 3 retrocopies | |
| Oryza barthii | OBART07G23140 | 1 retrocopy | |
| Oryza glumaepatula | OGLUM07G23200 | 1 retrocopy | |
| Oryza nivara | ONIVA07G23000 | 1 retrocopy |
retro_oniv_49 ,
|
| Oryza sativa japonica | OS07G0631100 | 1 retrocopy | |
| Sorghum bicolor | Sb10g003710 | 1 retrocopy | |
| Setaria italica | Si007595m.g | 2 retrocopies | |
| Triticum aestivum | Traes_1DL_84C83461E | 2 retrocopies |