RetrogeneDB ID: | retro_ogar_981 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873532.1:3170112..3170432(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ITGB1BP1 | ||
| Ensembl ID: | ENSOGAG00000001679 | ||
| Aliases: | None | ||
| Description: | integrin beta 1 binding protein 1 [Source:HGNC Symbol;Acc:23927] |
| Percent Identity: | 63.96 % |
| Parental protein coverage: | 54. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | YIDVAQQDGKLPFVPLEEEFI-MGVSKYGIKVSTSDQYDVLHRHAL-YLIIRMVCYDDGLGAGKSLLALK |
| Y.D.A.QDGKLPFVPL.EEFI..GVSK.G.KVS.SDQ...L.RHAL..LII.MV.YDDGLG.GK.L.A.K | |
| Retrocopy | YTDIA*QDGKLPFVPL*EEFI>RGVSKCGMKVSASDQKEFLQRHAL<RLIIWMVFYDDGLGLGKGLSAQK |
| Parental | TTDASNEEYSLWVY-QCNSLEQAQAICKVLSTAFDSVLTSE |
| ..D..NE..SLWV..QCNSLE....I...L.TAF.S.LTS. | |
| Retrocopy | -PDERNEGCSLWVV<QCNSLERPDTILTILHTAFYSALTSD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000013063 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013602 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006250 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008930 | 3 retrocopies | |
| Homo sapiens | ENSG00000119185 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001754 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006761 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000002359 | 7 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010629 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000018036 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013322 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003726 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001679 | 4 retrocopies | |
| Procavia capensis | ENSPCAG00000005976 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012667 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011637 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009799 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014537 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000859 | 1 retrocopy |