RetrogeneDB ID: | retro_ogar_750 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873527.1:5958068..5958295(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPE | ||
| Ensembl ID: | ENSOGAG00000004309 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide E [Source:HGNC Symbol;Acc:11161] |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MAYRGQGQKVQK-VMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTK |
| .AY.GQGQKVQ..VMVQPINLIFR.L.NR.R.Q.W.Y.QV.M...GCI.G.DEY.N.VLDDAEEIHSKTK | |
| Retrocopy | LAYCGQGQKVQR<VMVQPINLIFRHL*NRPRVQLWFYHQVDMWMKGCITGVDEYKNFVLDDAEEIHSKTK |
| Parental | SRKQLGK |
| SR.QLG. | |
| Retrocopy | SRRQLGR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |