RetrogeneDB ID: | retro_ogar_580 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873523.1:37757580..37757973(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FAM213A | ||
| Ensembl ID: | ENSOGAG00000013638 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 213, member A [Source:HGNC Symbol;Acc:28651] |
| Percent Identity: | 53.73 % |
| Parental protein coverage: | 57.64 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | EAADLSSLKPKLEELGIPLYAVV-KEQIGTEVKDFQPYFKGEIFLDEKKRFYGPQRRKMMFMGFIRLGVW |
| EAADL.SLKP....LG.PLYAVV.....G.......PYFKGEI.LDEK..F..P.RRK....G.I..GV. | |
| Retrocopy | EAADLFSLKPGSHKLGVPLYAVV>RKRSGLKCRS-SPYFKGEILLDEKEKFCDPRRRKNVSWGLIAVGVH |
| Parental | YN-FFRAWNGGYSGNLEGEGFILGGVFVVGSGKQXXXXXXXXXXFGDKVNLLSVLEAARKIKSQ |
| YN.FF.A.N...SG.LEG..FIL...FVVG.GKQ..........FG.K....SVLEAARK.K.Q | |
| Retrocopy | YN<FF*A*NRCSSGHLEGKAFILLRIFVVGLGKQGILLQQ*EKEFGSKASFFSVLEAARKTKPQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000813 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003657 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001981 | 3 retrocopies | |
| Homo sapiens | ENSG00000122378 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013246 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000007485 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021773 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021792 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013638 | 7 retrocopies |
retro_ogar_2126, retro_ogar_2435, retro_ogar_2562, retro_ogar_3327, retro_ogar_420, retro_ogar_580 , retro_ogar_784,
|
| Procavia capensis | ENSPCAG00000009696 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025862 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000002685 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011140 | 1 retrocopy |