RetrogeneDB ID: | retro_ocun_960 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 17:82945576..82945782(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FKBP1B | ||
| Ensembl ID: | ENSOCUG00000008793 | ||
| Aliases: | FKBP1B, FKBP12.6 | ||
| Description: | FK506 binding protein 1B, 12.6 kDa (FKBP1B), mRNA [Source:RefSeq mRNA;Acc:NM_001082145] |
| Percent Identity: | 58.57 % |
| Parental protein coverage: | 67.65 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | VSPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNK-PFKFRIGKQEVIKGFEEGAAQMSLGQRAKLT |
| ..P....TF.K.GQTC...YT..L...KKFDSSRDRNK..FK...GKQEVI.G.E....QMS.GQRA.LT | |
| Retrocopy | ICP*GSHTFQKRGQTCRGRYTKVLADEKKFDSSRDRNK<DFKLMLGKQEVIRGWEDRVGQMSVGQRAQLT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 3 .20 RPM | 20 .59 RPM |
| SRP017611_kidney | 0 .51 RPM | 1 .62 RPM |
| SRP017611_liver | 0 .15 RPM | 3 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Gorilla gorilla | ENSGGOG00000007752 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008793 | 6 retrocopies |