RetrogeneDB ID: | retro_ocun_728 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 14:141140548..141140764(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | H2AFZ | ||
| Ensembl ID: | ENSOCUG00000001888 | ||
| Aliases: | None | ||
| Description: | H2A histone family, member Z [Source:HGNC Symbol;Acc:4741] |
| Percent Identity: | 83.56 % |
| Parental protein coverage: | 57.48 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | YSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKG |
| Y.AAILEYLTAE.LE.AGNASKDLKVKRITP.HLQLAIRGD..LDSLIKATIAGGGVIPHIHKSL.G.K. | |
| Retrocopy | YRAAILEYLTAEGLEQAGNASKDLKVKRITPHHLQLAIRGDVKLDSLIKATIAGGGVIPHIHKSL-GRKD |
| Parental | QQK |
| ... | |
| Retrocopy | DRR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .11 RPM | 50 .50 RPM |
| SRP017611_kidney | 0 .00 RPM | 26 .45 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .56 RPM |