RetrogeneDB ID: | retro_ocun_1605 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018711:2707563..2707992(+) | ||
| Located in intron of: | ENSOCUG00000001833 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CWC15 | ||
| Ensembl ID: | ENSOCUG00000001629 | ||
| Aliases: | None | ||
| Description: | CWC15 spliceosome-associated protein homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:26939] |
| Percent Identity: | 51.33 % |
| Parental protein coverage: | 63.76 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | TTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKA |
| TTSSS..K.P.L.Q.P.A......PL.DEEDE..EE.S.DD.TAALL.E.EK...ER..EQARKE.E.KA | |
| Retrocopy | TTSSSAIKNPWLGQSPDAIFPTGEPLADEEDEGYEEGSVDD-TAALLEEPEKNYNERTGEQARKE*ELKA |
| Parental | -EEERIRMENILSGN-PLLNLTGPSQP-QANFKVKRRWDDDV-VFKNCAKGVDDQKKDKRFVNDTLRSEF |
| .EE.R...E.....N.PLLNLTGP.QP..ANF...RR.D....VF.NC.KG...Q.K........L.... | |
| Retrocopy | EEERRSVWETLWVNN<PLLNLTGPAQP<LANFQSHRRQDAVL<VFENCMKGTGEQEKGAYTIH*GL--TL |
| Parental | HKKFMEKYIK |
| .K.F.EK..K | |
| Retrocopy | RKSFREKSTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 52 .37 RPM |
| SRP017611_kidney | 0 .00 RPM | 56 .25 RPM |
| SRP017611_liver | 0 .00 RPM | 12 .79 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011392 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000007913 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004134 | 6 retrocopies | |
| Dipodomys ordii | ENSDORG00000011075 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006649 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007826 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002032 | 3 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000010404 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001629 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008490 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016534 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000407 | 1 retrocopy |