RetrogeneDB ID: | retro_oana_38 | ||
Retrocopylocation | Organism: | Platypus (Ornithorhynchus anatinus) | |
| Coordinates: | Contig167268:323..587(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOANG00000013963 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.23 % |
| Parental protein coverage: | 77.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | LEGRTEKIVETPYGKPSDALILGKIKNVDCVLLARHGRQHTIMPSAVNFQANIWALKEEGCTHIIVTTAC |
| ....T...V...Y.K....L.........C....RHGRQHTIMPSAVNFQANIWALKEEGCTHIIVTTAC | |
| Retrocopy | MDHTTQSLVLSFYSKQLKCLCVXXXXXLFC---HRHGRQHTIMPSAVNFQANIWALKEEGCTHIIVTTAC |
| Parental | GSLREEIQPGDIVLIDQFIDR |
| GSLREEIQPGDIVLIDQFIDR | |
| Retrocopy | GSLREEIQPGDIVLIDQFIDR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 6 .01 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .42 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .45 RPM |
| SRP007412_kidney | 0 .00 RPM | 18 .06 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .74 RPM |
| SRP007412_testis | 0 .00 RPM | 13 .64 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000025929 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000002224 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008021 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000825 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008670 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013214 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000015381 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000015072 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001137 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000013963 | 1 retrocopy |
retro_oana_38 ,
|
| Oryctolagus cuniculus | ENSOCUG00000012289 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000007889 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001259 | 1 retrocopy |