RetrogeneDB ID: | retro_nleu_542 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397267.1:16022886..16023097(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C14ORF2 | ||
| Ensembl ID: | ENSNLEG00000016248 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.79 % |
| Parental protein coverage: | 93.33 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | GTRGSDISHFQCQMLQSII-KNVWIPMKPYYTQVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPG |
| G.R.S....F...M.QSII.KNVWIPMKP.YTQ..QEIW.GMGL...I.YKIR.ADKRSKA.KA...AP. | |
| Retrocopy | GLRCSLSCWFCTEMFQSII>KNVWIPMKPSYTQACQEIWVGMGLISLIAYKIRSADKRSKA*KALSLAPA |
| Parental | H |
| H | |
| Retrocopy | H |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000026886 | 4 retrocopies | |
| Homo sapiens | ENSG00000156411 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002297 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016248 | 1 retrocopy |
retro_nleu_542 ,
|
| Pan troglodytes | ENSPTRG00000006764 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011548 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000043144 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000002550 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008996 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006404 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000001249 | 7 retrocopies |