RetrogeneDB ID: | retro_mputfur_745 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896943.1:2366434..2366658(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TNFRSF12A | ||
| Ensembl ID: | ENSMPUG00000015243 | ||
| Aliases: | None | ||
| Description: | tumor necrosis factor receptor superfamily, member 12A [Source:HGNC Symbol;Acc:18152] |
| Percent Identity: | 55.7 % |
| Parental protein coverage: | 59.69 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MLPGP-LRPLPRLLVLGLGLALLGAAGGERVPGTTPC-SRGSSWSADLDKCMDCASCPARPHSDFCLGCA |
| M.P.P.L.PL..LLVLGL..ALLGA...E.VPGT.P...R.SSWSADL.K..DC.SCP....SDF....A | |
| Retrocopy | MVPSPRLAPLRQLLVLGLERALLGASTQEQVPGTSPA<PRDSSWSADLRKFTDCTSCPP---SDFTVPSA |
| Parental | ASPPTSFPL |
| ...P..F.L | |
| Retrocopy | WASPQPFQL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Felis catus | ENSFCAG00000026197 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015243 | 1 retrocopy |
retro_mputfur_745 ,
|
| Otolemur garnettii | ENSOGAG00000008584 | 1 retrocopy |