RetrogeneDB ID: | retro_mputfur_530 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896918.1:13520728..13520955(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMPUG00000002168 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.82 % |
| Parental protein coverage: | 73.33 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | VTQYKKGKDSLYA-QGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHF |
| VTQY.K.KD.....QGK....R.Q.GYG.QTKPIF.KKA.T..KIVLR.E.VEP..RSKR..AIK...HF | |
| Retrocopy | VTQYEKDKDFHVS<QGKWCWERRQRGYGEQTKPIFQKKAETPEKIVLR*E*VEPKYRSKRTPAIK-SRHF |
| Parental | ELGGDKKR |
| E.GGD.KR | |
| Retrocopy | EQGGDNKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000008503 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017688 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000017385 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000025578 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000002168 | 3 retrocopies |
retro_mputfur_269, retro_mputfur_530 , retro_mputfur_94,
|
| Sarcophilus harrisii | ENSSHAG00000013479 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015808 | 1 retrocopy |