RetrogeneDB ID: | retro_mputfur_305 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896902.1:19831044..19831356(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | POLE4 | ||
| Ensembl ID: | ENSMPUG00000008356 | ||
| Aliases: | None | ||
| Description: | polymerase (DNA-directed), epsilon 4, accessory subunit [Source:HGNC Symbol;Acc:18755] |
| Percent Identity: | 61.4 % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | AAGSGTPLEEEGPSGEAAA-PQPQAPTSAPGARLSRLPLARVKALVKAD-PDVTLAGQEAIFILARAAEL |
| A.G......EEGP.G...A.P.P.......G....RLPLARVK.LV.AD.P.VTL.GQEAIFIL..A.E. | |
| Retrocopy | AKGGAGGAQEEGPRGKPGA<PKPSESSYQAGS--CRLPLARVKVLVEAD<PNVTLEGQEAIFILTQAWE- |
| Parental | FVETIAK-DAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTL |
| ...TIAK..AYCC.QQGKRKTLQ..D.DNA.EAVD.FAFLEGTL | |
| Retrocopy | ---TIAK<SAYCCVQQGKRKTLQGGDSDNALEAVDKFAFLEGTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017073 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017156 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000027003 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005983 | 1 retrocopy | |
| Homo sapiens | ENSG00000115350 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004491 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008356 | 1 retrocopy |
retro_mputfur_305 ,
|
| Nomascus leucogenys | ENSNLEG00000001111 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012258 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012105 | 1 retrocopy |