RetrogeneDB ID: | retro_mputfur_207 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896898.1:43106489..43106785(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMPUG00000003423 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase 1 beta subcomplex subunit 2, mitochondrial-like protein [Source:UniProtKB/TrEMBL;Acc:G9KCY4] |
| Percent Identity: | 59.05 % |
| Parental protein coverage: | 95.41 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | MSALTRLAPFVRAGGRLFRGPGSRAAGGSGVRHAGGGVHIEPRYRQFPQLTKSQVIQAEIFSG-TMWFWI |
| .SALT..A..V...G..FRG..S...GGSGVRHAG.GVHIE...R..PQL..SQV.QA..FSG.TM.F.. | |
| Retrocopy | LSALTWPALSVGIKGHFFRGHHSWVVGGSGVRHAGCGVHIEAQHR*LPQLIRSQVTQAKFFSG<TMGF-- |
| Parental | LWRFWHDSDAVLGHFAYPDPSQWTDEELGILPDDE |
| .W..W..S.A.LGHF.Y.DPS...DEELGILPDD. | |
| Retrocopy | -WFPW--SEAMLGHFPYLDPSR*ADEELGILPDDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000011176 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000003930 | 3 retrocopies | |
| Equus caballus | ENSECAG00000000877 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003423 | 3 retrocopies |
retro_mputfur_132, retro_mputfur_1443, retro_mputfur_207 ,
|
| Mus musculus | ENSMUSG00000002416 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000009644 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000013184 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000026616 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000015924 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000016495 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002566 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000547 | 2 retrocopies |