RetrogeneDB ID: | retro_mputfur_1226 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897046.1:2836869..2837109(+) | ||
| Located in intron of: | ENSMPUG00000004088 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0E2 | ||
| Ensembl ID: | ENSMPUG00000007307 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting V0 subunit e2 [Source:HGNC Symbol;Acc:21723] |
| Percent Identity: | 65. % |
| Parental protein coverage: | 98.77 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLITILAQLNPLFGPQLKN |
| M.......P.I....FWG..G...PWF.PKGPNRGVI.TMLV...VCC.LFWLI.ILAQLNPLFGPQLKN | |
| Retrocopy | MVYNGLTVPLIVMSVFWGFVGFCVPWFIPKGPNRGVITTMLVTCSVCCSLFWLIAILAQLNPLFGPQLKN |
| Parental | ETIWYVRFLW |
| ETIWY....W | |
| Retrocopy | ETIWYLKYQW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Loxodonta africana | ENSLAFG00000006800 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007307 | 2 retrocopies |
retro_mputfur_1226 , retro_mputfur_1441,
|