RetrogeneDB ID: | retro_mputfur_1153 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897028.1:6055419..6055823(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPB | ||
| Ensembl ID: | ENSMPUG00000009283 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptides B and B1 [Source:HGNC Symbol;Acc:11153] |
| Percent Identity: | 55.48 % |
| Parental protein coverage: | 61.04 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | PPP-KDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAA |
| PPP.KDTGIA.VPL.GAAGGPG.....G.G.PA..P.PQ.PAGLAG.V.GVG.PSQQVMTP.G..TVAAA | |
| Retrocopy | PPP>KDTGIAQVPLVGAAGGPGV----GGGVPASCPTPQVPAGLAGLVQGVGEPSQQVMTPEGKATVAAA |
| Parental | AAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGM---MGPPPGMRPPMGPPMGI-PPGRGTPMGMPPPG |
| .........G.P...P.G...PPP..G..APPPGM....GPP.G..P....P.G..PP..G..M....PG | |
| Retrocopy | TTQ*PL-LGGTPLT-PVGWVTPPP--GIMAPPPGMRSLTGPPTGLFPA*RTPVGM>PPIPG--MRPLSPG |
| Parental | MRPPPP |
| .R.PPP | |
| Retrocopy | IRGPPP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011353 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000006693 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020971 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007896 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000015568 | 3 retrocopies | |
| Felis catus | ENSFCAG00000014447 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000016519 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016951 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000009283 | 1 retrocopy |
retro_mputfur_1153 ,
|
| Mustela putorius furo | ENSMPUG00000014638 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009206 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016149 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000007459 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010841 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017013 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010040 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014498 | 2 retrocopies |