RetrogeneDB ID: | retro_mmus_718 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 11:66878455..66878673(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Hint1 | ||
| Ensembl ID: | ENSMUSG00000020267 | ||
| Aliases: | Hint1, AA673479, Hint, Ipk1, PKCI-1, PRKCNH1 | ||
| Description: | histidine triad nucleotide binding protein 1 [Source:MGI Symbol;Acc:MGI:1321133] |
| Percent Identity: | 67.53 % |
| Parental protein coverage: | 60.32 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | IIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVADDDDE-SLLGHLMIVGKKCAADLGL |
| I..KEI..KI.F.D..CLAFHDISPQAP.HFL.IPK..I.QISVA..DD..SLL..L.IVGKKCAADLGL | |
| Retrocopy | IFHKEILIKI-FKDSQCLAFHDISPQAPKHFLAIPK-NIVQISVAE-DDK<SLLRCLIIVGKKCAADLGL |
| Parental | KRGYRMV |
| ..G...V | |
| Retrocopy | NYGCQVV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 76 .09 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 88 .71 RPM |
| SRP007412_heart | 0 .00 RPM | 98 .90 RPM |
| SRP007412_kidney | 0 .00 RPM | 170 .96 RPM |
| SRP007412_liver | 0 .00 RPM | 161 .99 RPM |
| SRP007412_testis | 0 .00 RPM | 97 .42 RPM |