RetrogeneDB ID: | retro_mmus_423 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:28580500..28580746(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000086240 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Lsm5 | ||
| Ensembl ID: | ENSMUSG00000091625 | ||
| Aliases: | Lsm5, 2010208O10Rik, 2310034K10Rik | ||
| Description: | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1913623] |
| Percent Identity: | 97.56 % |
| Parental protein coverage: | 90.11 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | SQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNI |
| .QLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNI | |
| Retrocopy | TQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNI |
| Parental | TMLVPGGEGPEV |
| TMLVP.GEGPEV | |
| Retrocopy | TMLVPRGEGPEV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 1 .59 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .69 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .28 RPM |
| SRP007412_kidney | 0 .06 RPM | 1 .23 RPM |
| SRP007412_liver | 0 .05 RPM | 1 .37 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006700 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002332 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000010421 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018445 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
| Loxodonta africana | ENSLAFG00000029579 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091625 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000015268 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013892 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000019057 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000009786 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000004876 | 11 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004237 | 3 retrocopies |