RetrogeneDB ID: | retro_mmus_3516 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:121416130..121416419(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000083699 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Ube2w | ||
| Ensembl ID: | ENSMUSG00000025939 | ||
| Aliases: | Ube2w, 6130401J04Rik | ||
| Description: | ubiquitin-conjugating enzyme E2W (putative) [Source:MGI Symbol;Acc:MGI:1914049] |
| Percent Identity: | 74.26 % |
| Parental protein coverage: | 53.89 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 4 |
| Parental | DGFIMASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSR-YP |
| DGFIM.SM.K.LQKELLAL.N.PPPGMTLNEKS..NSI.Q.I.DME..PG.LYEGEK.QLLF.F.SR.YP | |
| Retrocopy | DGFIMVSMRKQLQKELLALKNYPPPGMTLNEKSI*NSIMQCILDMEVSPGRLYEGEKIQLLF*FNSR<YP |
| Parental | -FDSPQVMFTGE-NIPIHPHVYSNGH-ICLS |
| .F.SPQVMFTGE....I.PHVY.NGH.ICLS | |
| Retrocopy | <FESPQVMFTGE<KVHIYPHVYINGH>ICLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 42 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 22 .62 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 22 .21 RPM |
| SRP007412_liver | 0 .00 RPM | 14 .06 RPM |
| SRP007412_testis | 0 .09 RPM | 36 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Mus musculus | ENSMUSG00000001403 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000025939 | 1 retrocopy |
retro_mmus_3516 ,
|
| Ornithorhynchus anatinus | ENSOANG00000008597 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000010245 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027181 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000012043 | 2 retrocopies |