RetrogeneDB ID: | retro_mmus_3452 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:51753631..51753999(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Chchd3 | ||
| Ensembl ID: | ENSMUSG00000053768 | ||
| Aliases: | Chchd3, 0610041L09Rik, 1700039J09Rik, AW558177 | ||
| Description: | coiled-coil-helix-coiled-coil-helix domain containing 3 [Source:MGI Symbol;Acc:MGI:1913325] |
| Percent Identity: | 57.35 % |
| Parental protein coverage: | 58.59 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 3 |
| Parental | ERAAANEQLTRAVLRERISSEEERMKAKHLARQLEEKDR-VMRKQDAFY-KEQLARLEERSS-EFYKVTT |
| ERAA.NEQLTR.V..ERIS.EEE..KAKHL..QLE.K.R.V.R.....Y.KE..AR..ERSS..FYK..T | |
| Retrocopy | ERAAVNEQLTRVVIWERISTEEEHSKAKHLVWQLE*KAR<VIRNRRMLY>KELKAR-RERSS<DFYKLMT |
| Parental | EEYQKAAEEVEAKFKRYEYHPVCADLQTKILQCYRQNTQQTLSCSALASQYMHCVNHAKQSMLEKG |
| E.YQKA.EEV..KFK....HP....L.T.ILQCY....Q..L..S.L.S.Y...VNH.KQ..LEKG | |
| Retrocopy | ETYQKATEEVK-KFK----HPDWLHL*TRILQCY----QKALN*SILSS*YKYGVNHPKQRILEKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 34 .32 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 40 .34 RPM |
| SRP007412_heart | 0 .00 RPM | 231 .73 RPM |
| SRP007412_kidney | 0 .00 RPM | 143 .14 RPM |
| SRP007412_liver | 0 .00 RPM | 70 .29 RPM |
| SRP007412_testis | 0 .50 RPM | 103 .37 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_2874 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000001312 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004942 | 1 retrocopy | |
| Homo sapiens | ENSG00000106554 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000001671 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000053768 | 1 retrocopy |
retro_mmus_3452 ,
|
| Nomascus leucogenys | ENSNLEG00000012967 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000014032 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025827 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000019711 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013211 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000012111 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000022282 | 1 retrocopy |