RetrogeneDB ID: | retro_mmus_3439 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:36620182..36620459(+) | ||
| Located in intron of: | ENSMUSG00000059708 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rfk | ||
| Ensembl ID: | ENSMUSG00000024712 | ||
| Aliases: | Rfk, 0610038L10Rik, AF031381, KOI-4 | ||
| Description: | riboflavin kinase [Source:MGI Symbol;Acc:MGI:1914688] |
| Percent Identity: | 62.77 % |
| Parental protein coverage: | 60. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | STGIYYGWASVGSGDVHKMVVSI-GWNPYYKNVKKSMETHIIHTFKEDFYGEILNVAIVGYLRPEKNFDS |
| STG.YY....VGS...HKMVV...GWNP...NVKKS.E.HI..TFKEDFY.EIL.VA.V.YL.PEKNFDS | |
| Retrocopy | STGTYYSFSGVGSENAHKMVVNT>GWNP*RRNVKKSRESHIMYTFKEDFYEEILYVAVVAYLGPEKNFDS |
| Parental | LESLISAIQGDIEEAKKQLDLPEH |
| L..LIS.....IEE..K.LDLP.. | |
| Retrocopy | LVPLIS-VTHEIEETTK*LDLPQY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 44 .13 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 46 .94 RPM |
| SRP007412_heart | 0 .00 RPM | 47 .44 RPM |
| SRP007412_kidney | 0 .00 RPM | 93 .51 RPM |
| SRP007412_liver | 0 .00 RPM | 42 .77 RPM |
| SRP007412_testis | 0 .05 RPM | 18 .20 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_2863 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000031816 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000015769 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010358 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000988 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000001904 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000024712 | 1 retrocopy |
retro_mmus_3439 ,
|
| Oryctolagus cuniculus | ENSOCUG00000001622 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013120 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000019302 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000022273 | 5 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000015887 | 3 retrocopies |