RetrogeneDB ID: | retro_mmus_3360 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 9:78936586..78936783(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Cdc42se1 | ||
| Ensembl ID: | ENSMUSG00000046722 | ||
| Aliases: | Cdc42se1, 1300002M12Rik, AW558204, Cdcse1, SCIP1, Spec1 | ||
| Description: | CDC42 small effector 1 [Source:MGI Symbol;Acc:MGI:1889510] |
| Percent Identity: | 76.12 % |
| Parental protein coverage: | 82.5 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MSEFWHKLGCCVVEKPQPKKKRRRIDRTMI-GEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSK |
| MSEFWHKLGCCVVEKPQPKKKRR..DRTM..GEPM.FVHLTHIG..EMGA.DGLA.TGA.......K | |
| Retrocopy | MSEFWHKLGCCVVEKPQPKKKRRWTDRTML<GEPMSFVHLTHIG*EEMGAEDGLAITGARADEIQEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 46 .63 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 56 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 22 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 81 .25 RPM |
| SRP007412_liver | 0 .00 RPM | 21 .90 RPM |
| SRP007412_testis | 0 .00 RPM | 78 .90 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_153543 | 577 libraries | 449 libraries | 46 libraries | 0 libraries | 0 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015363 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007370 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019984 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000046722 | 1 retrocopy |
retro_mmus_3360 ,
|
| Tursiops truncatus | ENSTTRG00000007000 | 1 retrocopy |