RetrogeneDB ID: | retro_mmus_307 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:34985655..34985891(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Pfdn2 | ||
| Ensembl ID: | ENSMUSG00000006412 | ||
| Aliases: | None | ||
| Description: | prefoldin 2 [Source:MGI Symbol;Acc:MGI:1276111] |
| Percent Identity: | 76.25 % |
| Parental protein coverage: | 51.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | DSSGRVGKSGG-SGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCY |
| D.SG.VG...G.SG.GKGA..AE.V.AGFN.L.Q.QRGLASKAAEL.MELNEHSLVI.TLKEVDE.RK.Y | |
| Retrocopy | D*SGPVGRAAG<SGTGKGAGLAELVNAGFNLLQQGQRGLASKAAELAMELNEHSLVINTLKEVDEIRKSY |
| Parental | RMVGGVLVER |
| RMVGGVL.ER | |
| Retrocopy | RMVGGVLSER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 58 .83 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 88 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 42 .40 RPM |
| SRP007412_kidney | 0 .00 RPM | 63 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 46 .42 RPM |
| SRP007412_testis | 0 .00 RPM | 34 .30 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000004588 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004526 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000006412 | 1 retrocopy |
retro_mmus_307 ,
|
| Tupaia belangeri | ENSTBEG00000015982 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009181 | 1 retrocopy |