RetrogeneDB ID: | retro_mmus_2870 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 6:125208443..125208693(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Rpl24 | ||
| Ensembl ID: | ENSMUSG00000022601 | ||
| Aliases: | Zbtb11, 9230110G02Rik, ZNF-U69274 | ||
| Description: | ribosomal protein L24 [Source:MGI Symbol;Acc:MGI:1915443] |
| Percent Identity: | 50.59 % |
| Parental protein coverage: | 53.5 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | FSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFL-SKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAV |
| FS.YKIYP..G..Y.RTD..V.QFLNAKC....L.SKRNP.QINWTVLYR.............K..RR.. | |
| Retrocopy | FSRYKIYPKQGQNYTRTDQEVSQFLNAKCKCTCL>SKRNPWQINWTVLYRXXXXXXXXXXNSWKKFRRKE |
| Parental | KFQRAITGASLADIM |
| .....I.G.SLA... | |
| Retrocopy | ATAKSI-GPSLAHLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 83 .94 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 81 .85 RPM |
| SRP007412_heart | 0 .00 RPM | 59 .33 RPM |
| SRP007412_kidney | 0 .02 RPM | 59 .77 RPM |
| SRP007412_liver | 0 .00 RPM | 60 .76 RPM |
| SRP007412_testis | 0 .00 RPM | 67 .05 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Mus musculus | ENSMUSG00000022601 | 13 retrocopies |