RetrogeneDB ID: | retro_mmus_2539 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:155502320..155502705(-) | ||
| Located in intron of: | ENSMUSG00000029064 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000082429 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Ndufb7 | ||
| Ensembl ID: | ENSMUSG00000033938 | ||
| Aliases: | Ndufb7, 1110002H15Rik | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 [Source:MGI Symbol;Acc:MGI:1914166] |
| Percent Identity: | 83.97 % |
| Parental protein coverage: | 94.16 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | RYLWDASVEPDPEKIPSFPPDLGFPERKERVMVATQQEMMDAQLTLQQRDYCAHYL-IRLLKCKRDSFPN |
| R.LWDASVEPD.EK.PSFP.DLGFP.RKERV.VATQQE.MDAQ.TLQ.RDYCAHYL...LLKC.RDS.P. | |
| Retrocopy | RVLWDASVEPDLEKTPSFPTDLGFPKRKERVTVATQQEIMDAQVTLQRRDYCAHYL<TQLLKCNRDSLPG |
| Parental | -FLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRRALKEARVAQGQGEGEVGPEVA |
| .FLACK.EQH.WDYCEHLDYVK.MKEFERE.RLLQRKKRRALKEARVAQGQG.GEVGPEVA | |
| Retrocopy | <FLACKREQHSWDYCEHLDYVKHMKEFEREQRLLQRKKRRALKEARVAQGQGDGEVGPEVA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 40 .07 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 54 .45 RPM |
| SRP007412_heart | 0 .03 RPM | 204 .59 RPM |
| SRP007412_kidney | 0 .10 RPM | 122 .76 RPM |
| SRP007412_liver | 0 .03 RPM | 56 .26 RPM |
| SRP007412_testis | 0 .09 RPM | 48 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011470 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016258 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000015213 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000033938 | 1 retrocopy |
retro_mmus_2539 ,
|
| Otolemur garnettii | ENSOGAG00000009615 | 1 retrocopy |